PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa08g060700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 279aa    MW: 32008.4 Da    PI: 9.3114
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa08g060700.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.81.9e-18123175456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + ++t+ ql  Le+ F+++ +++ +++ +L+++lgL+ rq+ vWFqNrRa++k
  Csa08g060700.1 123 KKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWK 175
                     45699***********************************************9 PP

2HD-ZIP_I/II116.12.1e-37122212292
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     kk+rl++ q+++LE+sF+ee kL+++rKv+l+reLglqprq+avWFqnrRAR+k+kqlE+ y++L+++yd +++e+++L++ev++Lr+ l+
  Csa08g060700.1 122 KKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAVWFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHEEVKKLRAILR 212
                     9**************************************************************************************8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.84E-18112179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-19115180IPR009057Homeodomain-like
PROSITE profilePS5007116.487117177IPR001356Homeobox domain
SMARTSM003894.5E-17119181IPR001356Homeobox domain
CDDcd000866.64E-15122178No hitNo description
PfamPF000465.7E-16123175IPR001356Homeobox domain
PRINTSPR000315.4E-5148157IPR000047Helix-turn-helix motif
PROSITE patternPS000270152175IPR017970Homeobox, conserved site
PRINTSPR000315.4E-5157173IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEWSTTSNVE NVRVAFMPPP WAPESSSFNS LHSFGFDPYA GIFTRHINTK YICRCFRFLT  60
QWCRFNSKLD KPFCCVLTSG ILYTPPADTQ TGPVIAVPEP EKIMNAYRFP NNDNNNNEMM  120
IKKKRLTSGQ LASLERSFQE EIKLDSDRKV KLSRELGLQP RQIAVWFQNR RARWKAKQLE  180
QLYDSLRQEY DVVSREKQML HEEVKKLRAI LRDQGLIKKP ISAGTIKVSS EEDTAELPSV  240
VVAHPRTENL NTGGNQIYGT DQYNNPMMVA SSGWSSYQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169177RRARWKAKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3520291e-134EU352029.1 Arabidopsis lyrata At5g03790-like protein gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010423661.11e-164PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR01e-141ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLR0FIS61e-147R0FIS6_9BRAS; Uncharacterized protein
STRINGAT5G03790.11e-139(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16602888
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.11e-140homeobox 51